DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and pk

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster


Alignment Length:273 Identity:68/273 - (24%)
Similarity:100/273 - (36%) Gaps:67/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTEKI--VNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYC------------------ERDF 74
            |.:|:  |||.||.:..:..:  ....|..:.:       :||                  :||.
  Fly   554 PDDKVPYVNSPGEQYRVRQLL--HQLPPHDNEV-------RYCHSLTDEERKELRLFSTQRKRDA 609

  Fly    75 -------HVLFAPCCNKC------GEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNR 126
                   .::.|..|:.|      |:..:.......:|||||.||.|.:|.:.|.|..:.....|
  Fly   610 LGRGNVRQL
MSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGR 674

  Fly   127 ALCHECNAKVKAEITGRYVCQKCHGLI-DEEPLRFRGEVYHGYHFSCTACGTELDS---TAREVK 187
            ..|...:|:     |.:..|..|..:| .:|.....|..:|..||:|..|..:|..   ..||.|
  Fly   675 MYCGRHHA
E-----TLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGK 734

  Fly   188 SRPGLAANDMNELYCLRCHDKMGIPICGACRRPI--EERVVTALGKHWHV--EHFVCAKCEKPFL 248
            .            |||.|.|.|....|..|...|  ::..::..|:|||.  |.|.|..|....|
  Fly   735 P------------YCLHCFD
AMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSLL 787

  Fly   249 GHRHYEKRGLAYC 261
            |.....:||..||
  Fly   788 GRAFLPRRGAIYC 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 12/75 (16%)
LIM2_PINCH 82..133 CDD:188718 16/56 (29%)
LIM3_PINCH 146..206 CDD:188719 17/63 (27%)
LIM4_PINCH 212..265 CDD:188720 17/54 (31%)
LIM5_PINCH 273..326 CDD:188721
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 12/72 (17%)
LIM1_Prickle 624..682 CDD:188799 16/57 (28%)
LIM2_Prickle 687..742 CDD:188802 18/66 (27%)
LIM3_Prickle 747..805 CDD:188804 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
43.820

Return to query results.
Submit another query.