DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and tes

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001004961.1 Gene:tes / 448383 XenbaseID:XB-GENE-1015357 Length:422 Species:Xenopus tropicalis


Alignment Length:249 Identity:55/249 - (22%)
Similarity:82/249 - (32%) Gaps:78/249 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HCTRCADGFEPTEKIVNSN----GELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAP 80
            :|.||.:.....:..|.:.    .:|||..||||..|.....|.|::...|:.||.|.:.....|
 Frog   235 YCFRCKENMREGDPAVYAERAGYDKLWHPSCFVCFTCNELLVDMIYFWKNGKLYCGRHYCDSEKP 299

  Fly    81 CCNKCGEFVI-GRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRY 144
            .|..|.|.:. ....:|...:||.:.|.|..|...||...::...::.:|..|..|..|     .
 Frog   300 RCAGCDELIFSNEYTQAEGLNWHLKHFCCFDCDCVLAGEIYVMVNDKPVCKLCYVKNHA-----V 359

  Fly   145 VCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKM 209
            .||.||..||.|..|..   |:|:                                         
 Frog   360 SCQGCHNAIDPEVQRVS---YNGF----------------------------------------- 380

  Fly   210 GIPICGACRRPIEERVVTALGKHWHV--EHFVCAKCEKPFLGHRHYEKRGLAYC 261
                                  |||.  |.|:|:.|.|..:|.:....:|:.:|
 Frog   381 ----------------------HWHAAPECFICSCCSKCLIGQKFMPIQGMVFC 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/61 (30%)
LIM2_PINCH 82..133 CDD:188718 12/51 (24%)
LIM3_PINCH 146..206 CDD:188719 10/59 (17%)
LIM4_PINCH 212..265 CDD:188720 11/52 (21%)
LIM5_PINCH 273..326 CDD:188721
tesNP_001004961.1 PET_testin 109..195 CDD:193604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..165
LIM1_Testin 236..293 CDD:188797 18/56 (32%)
LIM2_Testin 299..354 CDD:188800 14/54 (26%)
LIM3_Testin 361..419 CDD:188803 21/118 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.