DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fhl1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001006703.1 Gene:fhl1 / 448334 XenbaseID:XB-GENE-964257 Length:296 Species:Xenopus tropicalis


Alignment Length:303 Identity:82/303 - (27%)
Similarity:119/303 - (39%) Gaps:56/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAP-----CCNKCGEF-----VIGRVIKAMSASW 101
            |.|..|..|.|        |:||.|:|.|.....     |.|.|.|.     |..:.:...:..|
 Frog    21 FDCHYCRAPLQ--------GKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYW 77

  Fly   102 HPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEP----LRFRG 162
            |..||||..|...||:..||...|:.:|.:|..:   |.:.|  |..||..|  :|    :.::|
 Frog    78 HDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTR---EDSLR--CSGCHKQI--QPGGRNVEYKG 135

  Fly   163 EVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVT 227
            ..:|...|:|:.|...:.|.:...|.         .::||:.||::.....|..|..||....:|
 Frog   136 SAWHEECFTCSNCKQAIGSGSFFPKG---------TDVYCVTCHEQKFAKNCVKCNNPITSGGIT 191

  Fly   228 ALGKHWHVEHFVCAKCEKPFLGHR------HYEKRGLAYCETHYHQLFGNLCFVCNQVI-----G 281
            ...:.||.:.|||..|.|...|.|      ||      ||...|.......|..||..|     |
 Frog   192 YQDQPWHGDCFVCETCHKKLAGQRFTAVEDHY------YCVDCYKSFVAKKCAGCNNPITGFGKG 250

  Fly   282 GDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKC 324
            .:|......:|..:.|.|..|...:..| :|..::|:..|:.|
 Frog   251 SNVVNYEGNSWHEYCFTCKKCSLNLANK-RFVRHNEQVYCQDC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 11/31 (35%)
LIM2_PINCH 82..133 CDD:188718 17/55 (31%)
LIM3_PINCH 146..206 CDD:188719 14/63 (22%)
LIM4_PINCH 212..265 CDD:188720 18/58 (31%)
LIM5_PINCH 273..326 CDD:188721 15/57 (26%)
fhl1NP_001006703.1 LIM1_FHL1 56..109 CDD:188730 16/52 (31%)
LIM2_FHL1 117..174 CDD:188808 16/67 (24%)
LIM3_FHL1 178..230 CDD:188813 18/57 (32%)
LIM4_FHL1 233..296 CDD:188734 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.