DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and smash

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster


Alignment Length:102 Identity:23/102 - (22%)
Similarity:38/102 - (37%) Gaps:36/102 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CNKCGE------FVIG-----RVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAK 135
            |:.||:      :.:|     .:|:::...:|..||:|.:|..:|.| |......|...|:.:  
  Fly  1464 CSHCGDELGKLCYYVGCRGAAMIIESLLLFYHINCFKCCVCHVQLGD-GLNGTDVRVRNHKLH-- 1525

  Fly   136 VKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSC 172
                      ||.|:...|            |..|||
  Fly  1526 ----------CQNCYSSDD------------GIKFSC 1540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 15/61 (25%)
LIM3_PINCH 146..206 CDD:188719 8/27 (30%)
LIM4_PINCH 212..265 CDD:188720
LIM5_PINCH 273..326 CDD:188721
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.