DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and tes

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_991283.2 Gene:tes / 403032 ZFINID:ZDB-GENE-040718-59 Length:541 Species:Danio rerio


Alignment Length:266 Identity:64/266 - (24%)
Similarity:91/266 - (34%) Gaps:90/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AANMSLGA----MHCTRCADGFEPTEKIVNSN----GELWHTQCFVCAQCFRPFQDGIFYEFEGR 67
            ||..|.|.    ..|.:|....:..|..|.:.    .:|||..||||..|.....|.|::..:|:
Zfish   340 AAGTSAGGPAGNFSCHQCQKPMKKGEPAVFAERAGYDKLWHPACFVCCTCTELLVDMIYFWKKGQ 404

  Fly    68 KYCERDFHVLFAPCCNKCGEFVI-GRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHE 131
            .||.|.:.....|.|..|.|.:. ....:|...:||.:.|           |          |.:
Zfish   405 LYCGRHYGDSEKPRCGGCDELIFSNEYTQAEGQNWHLKHF-----------C----------CFD 448

  Fly   132 CNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAAND 196
            |:..:..|   .||.:|      |:|:                                      
Zfish   449 CDCVLAGE---TYVMEK------EKPV-------------------------------------- 466

  Fly   197 MNELYCLRCHDKMGIPICGACRRPIE---ERVVTALGK-HWHVEH--FVCAKCEKPFLGHRHYEK 255
                 |..|:.|.....|.||::|||   :||  :.|: |||.|.  |.||.|.|..:|.|....
Zfish   467 -----CKPCYMKNHAVCCVACQKPIEPESQRV--SYGEHHWHAEPQCFQCAGCSKCLMGQRFMAL 524

  Fly   256 RGLAYC 261
            :|...|
Zfish   525 QGKLIC 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/61 (30%)
LIM2_PINCH 82..133 CDD:188718 9/51 (18%)
LIM3_PINCH 146..206 CDD:188719 4/59 (7%)
LIM4_PINCH 212..265 CDD:188720 22/56 (39%)
LIM5_PINCH 273..326 CDD:188721
tesNP_991283.2 PET_testin 205..291 CDD:193604
Collagen 295..350 CDD:189968 4/9 (44%)
LIM1_Testin 354..411 CDD:188797 18/56 (32%)
LIM2_Testin 417..472 CDD:188800 19/127 (15%)
LIM3_Testin 479..537 CDD:188803 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.