DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and PRICKLE3

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_006141.2 Gene:PRICKLE3 / 4007 HGNCID:6645 Length:615 Species:Homo sapiens


Alignment Length:266 Identity:70/266 - (26%)
Similarity:101/266 - (37%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTEKI--VNSNGE------LWH------TQCFVCAQC-------FRPFQDGIFYEFEGRKYCERD 73
            |.:|:  |||.||      |.|      ::...|...       .|.|......|..||... |.
Human   113 PEDKVPYVNSPGEKYRIKQLLHQLPPHDSEAQYCTALEEEEKKELRAFSQQRKRENLGRGIV-RI 176

  Fly    74 FHV-LFAPCCNKCGEFVIGRVI------KAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHE 131
            |.| :....|.:||:.:.|..|      ..:.|.||||||.|..|.:.|.|..:..:..:..|..
Human   177 FP
VTITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCTTCQELLVDLIYFYHVGKVYCGR 241

  Fly   132 CNAKVKAEITGRYVCQKCHGLI-DEEPLRFRGEVYHGYHFSCTACGTELDSTAREVK-SRPGLAA 194
            .:|:..     |..||.|..:| ..|.....|..:|..||.|..|...|......:: |||    
Human   242 HHA
ECL-----RPRCQACDEIIFSPECTEAEGRHWHMDHFCCFECEASLGGQRYVMRQSRP---- 297

  Fly   195 NDMNELYCLRCHDKMGIPICGACRRPI--EERVVTALGKHWHVEH--FVCAKCEKPFLGHRHYEK 255
                  :|..|::......|..|...|  ::..:...|:|||...  |.|::|.:..||.....:
Human   298 ------HCCACYE
ARHAEYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPR 356

  Fly   256 RGLAYC 261
            |||.:|
Human   357 RGLIFC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/70 (26%)
LIM2_PINCH 82..133 CDD:188718 17/56 (30%)
LIM3_PINCH 146..206 CDD:188719 16/61 (26%)
LIM4_PINCH 212..265 CDD:188720 16/54 (30%)
LIM5_PINCH 273..326 CDD:188721
PRICKLE3NP_006141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PET_Prickle 82..178 CDD:193602 16/65 (25%)
LIM1_Prickle 186..244 CDD:188799 17/57 (30%)
LIM2_Prickle 249..304 CDD:188802 17/64 (27%)
LIM3_Prickle 309..367 CDD:188804 16/54 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..567
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..615
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.