DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fhl1a

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001007288.1 Gene:fhl1a / 399646 ZFINID:ZDB-GENE-040206-1 Length:297 Species:Danio rerio


Alignment Length:300 Identity:83/300 - (27%)
Similarity:124/300 - (41%) Gaps:43/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TQCFVCAQCFRPFQDGIFYEFEGRKY--------CERDFHVLFAPCCNKCGEFVIGRVIKAM--- 97
            |:.|.|..|    :|.:    :|:||        |.|.|..|.|..|.:|.: .||...|.:   
Zfish    18 TERFDCFYC----RDNL----QGKKYVKKDDKPVCVRCFDKLCANTCAECRK-PIGADAKELNHK 73

  Fly    98 SASWHPQCFRCQLCAKELADCGF-IKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDE--EPLR 159
            :..||..||||..|.|.||:..| .|:..:.:|.:|..:     .|...||.|:.:|..  :.:.
Zfish    74 NRHWHEGCFRCAKCYKPLANEPFQAKDDGKIMCGKCGDR-----DGSPRCQGCYKVITPGCKNVE 133

  Fly   160 FRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEER 224
            ::.:|:|...|:|..|       .:.::::..|...|  ::||..||:|.....|..|:..|...
Zfish   134 YKHKVWHEECFTCFEC-------KQPIRTQSFLTKGD--DMYCTPCHEKKFAKHCVRCKEAITSG 189

  Fly   225 VVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI-----GGDV 284
            .:|...:.||.|.|||..|:||..|.|........||...|.......|..|...|     |.:|
Zfish   190 GLTYQDQPWHSECFVCHTCKKPLAGARFTAHEDQFYCVDCYKSDVAKKCSGCQNPITGFGRGTNV 254

  Fly   285 FTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKC 324
            ....:|:|..:.|.|..|...|..| :|....|...|..|
Zfish   255 VNYEDKSWHEYCFNCKKCSLSMAHK-RFVINGEDIYCSDC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 12/42 (29%)
LIM2_PINCH 82..133 CDD:188718 18/54 (33%)
LIM3_PINCH 146..206 CDD:188719 13/61 (21%)
LIM4_PINCH 212..265 CDD:188720 17/52 (33%)
LIM5_PINCH 273..326 CDD:188721 15/56 (27%)
fhl1aNP_001007288.1 LIM <21..49 CDD:295319 9/35 (26%)
LIM1_FHL1 56..110 CDD:188730 18/54 (33%)
LIM2_FHL1 118..175 CDD:188808 16/65 (25%)
LIM3_FHL1 179..231 CDD:188813 17/51 (33%)
LIM4_FHL1 234..297 CDD:188734 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.