DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and lmcd1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_957364.2 Gene:lmcd1 / 394045 ZFINID:ZDB-GENE-040426-1067 Length:342 Species:Danio rerio


Alignment Length:112 Identity:33/112 - (29%)
Similarity:51/112 - (45%) Gaps:7/112 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HCTRCADGFEPTEKIVNSN----GELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAP 80
            :|:.|.......|.:|.::    ..|||..||||.:|.....|.|::..||...|.|.:.....|
Zfish   229 YCSGCGQLAAMDEPVVYADRAGYERLWHPACFVCGECGEALVDLIYFWKEGALLCGRHYCQSIRP 293

  Fly    81 CCNKCGEFVIGRVI--KAMSASWHPQCFRCQLCAKEL-ADCGFIKNQ 124
            .|..|.|.:...::  :|....||.:.|.|.||.::: .:||..|.|
Zfish   294 RCLGCDELIFSDMLLQEASGHVWHKEHFCCWLCGQDIRVECGCDKRQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/61 (30%)
LIM2_PINCH 82..133 CDD:188718 14/46 (30%)
LIM3_PINCH 146..206 CDD:188719
LIM4_PINCH 212..265 CDD:188720
LIM5_PINCH 273..326 CDD:188721
lmcd1NP_957364.2 PET_testin 102..189 CDD:193604
LIM1_Testin_like 230..287 CDD:188726 18/56 (32%)
LIM 293..>326 CDD:295319 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.