DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Zasp67

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster


Alignment Length:169 Identity:38/169 - (22%)
Similarity:58/169 - (34%) Gaps:68/169 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 DKMGIPI------------CGACR-----RPIEERVVTALGKHWHV--EHFVCAKCEKPFLG--- 249
            |:.|:|:            |.|..     :.:||.:...|.....|  ||.|        ||   
  Fly   190 DEGGLPVENLYLPDLPDRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNV--------LGVNF 246

  Fly   250 HRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKM------TQ 308
            :|.:.|.|                 ||   :..||..:||:         .|..||:      .|
  Fly   247 YRIFPKPG-----------------VC---MSSDVLRSLNE---------EVTKTKLEKDKENRQ 282

  Fly   309 KSKFYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKN 347
            .|.|.:...:||.|   .:...|..||...|:::|:.|:
  Fly   283 WSTFLQRPNRPVPK---SKQSLEAERRAANAYKVTIVKS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718
LIM3_PINCH 146..206 CDD:188719
LIM4_PINCH 212..265 CDD:188720 15/74 (20%)
LIM5_PINCH 273..326 CDD:188721 15/58 (26%)
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.