DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fhl1b

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_954687.1 Gene:fhl1b / 387528 ZFINID:ZDB-GENE-031219-1 Length:280 Species:Danio rerio


Alignment Length:309 Identity:82/309 - (26%)
Similarity:113/309 - (36%) Gaps:65/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TQCFVCAQCFRPFQDGIFYEFEGRKY--------CERDFHVLFAPCCNKCGEFVIGRVIKAMSAS 100
            :.||.|.:           :..|:|:        |.|.|....|..|.:|     .|.|...|..
Zfish     5 SNCFYCRE-----------DLSGKKFVRKDEKQVCVRCFDKFCANTCTEC-----RRTISTDSKE 53

  Fly   101 -------WHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHG-----LI 153
                   ||..||||..|.|.||...|....:|.||..|:::..|        .:|||     |.
Zfish    54 LHHKGKYWHSDCFRCAKCYKNLAKESFTSKDDRILCGTCSSREDA--------PRCHGCYKPILP 110

  Fly   154 DEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACR 218
            ..|.:.::|..:|...|.|..|...:.:.:...|:         |.:||..||:|.....|..|:
Zfish   111 GTENVEYKGNSWHDECFKCYQCQKPIGNKSFITKN---------NNVYCSPCHEKKFAKQCACCK 166

  Fly   219 RPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR---HYEKRGLAYCETHYHQLFGNLCFVCNQVI 280
            :||....|....:.||.|.|||:.|.||..|.|   |.||   .||...|.......|..|...|
Zfish   167 KPITTGGVNYQDQPWHSECFVCSSCRKPLAGTRFTSHEEK---VYCVDCYKSTVAKKCSGCQNPI 228

  Fly   281 GG-----DVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKC 324
            .|     :|......:|..:.|.|..|...:..| :|..:.....|..|
Zfish   229 TGFGKATNVVNYEGGSWHDYCFNCKKCSLNLADK-RFVAHSGHIYCSDC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 8/42 (19%)
LIM2_PINCH 82..133 CDD:188718 19/57 (33%)
LIM3_PINCH 146..206 CDD:188719 14/64 (22%)
LIM4_PINCH 212..265 CDD:188720 21/55 (38%)
LIM5_PINCH 273..326 CDD:188721 13/57 (23%)
fhl1bNP_954687.1 LIM1_FHL1 40..93 CDD:188730 19/57 (33%)
LIM2_FHL1 101..158 CDD:188808 17/65 (26%)
LIM3_FHL1 162..214 CDD:188813 21/54 (39%)
LIM4_FHL1 217..280 CDD:188734 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.