DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and prickle2b

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_899186.1 Gene:prickle2b / 368250 ZFINID:ZDB-GENE-030724-6 Length:840 Species:Danio rerio


Alignment Length:216 Identity:61/216 - (28%)
Similarity:88/216 - (40%) Gaps:39/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CNKCGEFVIGRVIKAMSAS-------WHPQCFRCQLCAKELADCGFIKNQNRALCHECNA-KVKA 138
            |.:||..:.|..| |:.||       ||||||.|.:|.:.|.|..:.....:..|...:| ::|.
Zfish   126 CEQCGGQINGGDI-AVFASRAGHGVCWHPQCFVCSMCDELLVDLIYFYQDGKIFCGRHHAERLKP 189

  Fly   139 EITGRYVCQKCHGLI-DEEPLRFRGEVYHGYHFSCTACGTELDSTAREVK-SRPGLAANDMNELY 201
            .      |..|..:| .:|.....|..:|..||.|..|.|.|......:| .||          |
Zfish   190 R------CSACDEIILADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGRP----------Y 238

  Fly   202 CLRCHDKMGIPICGACRR--PIEERVVTALGKHWHVEH--FVCAKCEKPFLGHRHYEKRGLAYCE 262
            |..|.:.:....|.:|..  .|::..:|..|:|||...  |.||:|:|..||.....|:|..:| 
Zfish   239 CCTCFESLYAEYCDSCGEHIGIDQGQMTYDGQHWHATEACFSCARCKKSLLGRPFLPKQGQIFC- 302

  Fly   263 THYHQLFGNLCFVCNQVIGGD 283
                   ...|.|.::..|.|
Zfish   303 -------SRACSVGDEQNGSD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 19/57 (33%)
LIM3_PINCH 146..206 CDD:188719 17/61 (28%)
LIM4_PINCH 212..265 CDD:188720 18/56 (32%)
LIM5_PINCH 273..326 CDD:188721 4/11 (36%)
prickle2bNP_899186.1 PET_Prickle 22..118 CDD:193602
LIM1_Prickle 126..184 CDD:188799 19/58 (33%)
LIM2_Prickle 189..244 CDD:188802 18/70 (26%)
LIM3_Prickle 249..307 CDD:188804 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.