DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Pxn

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_038945530.1 Gene:Pxn / 360820 RGDID:1305759 Length:1125 Species:Rattus norvegicus


Alignment Length:322 Identity:95/322 - (29%)
Similarity:133/322 - (41%) Gaps:81/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKAEVVQAANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRK 68
            :|..|...|....||  |.:...|     ::|.:.|:.||.:.|||..|........|:|.:|:.
  Rat   880 NKLGVATVAKGVCGA--CKKPIAG-----QVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQP 937

  Fly    69 YCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECN 133
            |||:|:|.||:|.|..|...::.:|:.|:..:|||:.|.|       |.||              
  Rat   938 YCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFC-------AQCG-------------- 981

  Fly   134 AKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMN 198
                                     .|.|.  .|:|        |.|..|               
  Rat   982 -------------------------AFFGP--EGFH--------EKDGKA--------------- 996

  Fly   199 ELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCET 263
              ||.:.:..|..|.||.|.|.|.|..::||...||.|.|||.:|..||:....:|..|..|||.
  Rat   997 --YCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEV 1059

  Fly   264 HYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKCY 325
            |||:..|:||..|.:.|.|...||:.|.:...||.|:.| .|...|..|.|.::||.|:.|:
  Rat  1060 HYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFC-LKQLNKGTFKEQNDKPYCQSCF 1120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 19/57 (33%)
LIM2_PINCH 82..133 CDD:188718 12/50 (24%)
LIM3_PINCH 146..206 CDD:188719 9/59 (15%)
LIM4_PINCH 212..265 CDD:188720 23/52 (44%)
LIM5_PINCH 273..326 CDD:188721 19/53 (36%)
PxnXP_038945530.1 Paxillin 121..320 CDD:397550
LIM1_Paxillin_like 892..944 CDD:259830 19/58 (33%)
LIM2_Paxillin 951..1002 CDD:188791 21/123 (17%)
LIM3_Paxillin_like 1010..1062 CDD:188724 23/51 (45%)
LIM4_Paxillin 1069..1120 CDD:188795 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.