DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and CG31624

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:92/245 - (37%) Gaps:77/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVC 146
            |:||.|.:..|:|.|:..:|||:.|.|..|.:::.|..|            |.:     :|..||
  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATF------------NVQ-----SGEPVC 54

  Fly   147 QKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGI 211
            .||              ....|.::                                        
  Fly    55 NKC--------------FVERYTYT---------------------------------------- 65

  Fly   212 PICGACRRPIEERVVTALGKHWHVEHFVC-AKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFV 275
              |..|::||.|:.:.|:|:.||...|.| ..|:||......||:.|..||:..|..||...|..
  Fly    66 --CAGCKKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAK 128

  Fly   276 CNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYD-EKPVCKKC 324
            |.:.|......|:|..|..:.|.|:.|:..:|  |:.:..| :||||..|
  Fly   129 CEKPITDSAVLAMNVKWHRNCFQCNKCENPIT--SQTFTIDGDKPVCPAC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 15/50 (30%)
LIM3_PINCH 146..206 CDD:188719 4/59 (7%)
LIM4_PINCH 212..265 CDD:188720 19/53 (36%)
LIM5_PINCH 273..326 CDD:188721 17/53 (32%)
CG31624NP_001163031.1 LIM 7..58 CDD:351770 21/81 (26%)
LIM 66..118 CDD:351770 19/51 (37%)
LIM 125..176 CDD:214528 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I3371
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
65.960

Return to query results.
Submit another query.