DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and jub

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_572930.3 Gene:jub / 32351 FlyBaseID:FBgn0030530 Length:728 Species:Drosophila melanogaster


Alignment Length:267 Identity:63/267 - (23%)
Similarity:101/267 - (37%) Gaps:95/267 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLF------A 79
            |..|.:..:...:...:.|.|:||.||:|..|.|..:...||...||.|||.|:  ::      |
  Fly   516 CHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDY--MYSGFQQTA 578

  Fly    80 PCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRY 144
            ..|..||..::..:::||..|:||.||||                  .:|:||            
  Fly   579 EKCAICGHLIMEMILQAMGKSYHPGCFRC------------------CVCNEC------------ 613

  Fly   145 VCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKM 209
                    :|..|  |..:|.|                                ::||:..:.:|
  Fly   614 --------LDGVP--FTVDVDH--------------------------------KIYCVNDYHRM 636

  Fly   210 GIPICGACRR---PIE---ERV-VTALGKHWHVEHFVCAKC-----EKPFLGHRHYEKRGLAYCE 262
            ..|.|.:|.:   |:|   |.| |.::.|.:||:.::|.:|     ::|  ..|.|...|...|.
  Fly   637 FAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCYICEECGMQLTDEP--DKRCYPLDGRLLCR 699

  Fly   263 -THYHQL 268
             .|..:|
  Fly   700 GCHLQRL 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 19/63 (30%)
LIM2_PINCH 82..133 CDD:188718 14/50 (28%)
LIM3_PINCH 146..206 CDD:188719 7/59 (12%)
LIM4_PINCH 212..265 CDD:188720 18/65 (28%)
LIM5_PINCH 273..326 CDD:188721
jubNP_572930.3 LIM1_Ajuba_like 516..569 CDD:188738 18/52 (35%)
LIM2_Ajuba_like 581..633 CDD:188741 22/123 (18%)
LIM3_Ajuba_like 641..702 CDD:188822 17/62 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.