DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Zyx

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster


Alignment Length:232 Identity:59/232 - (25%)
Similarity:98/232 - (42%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKS 188
            :|...|.:||::|..|.:|      |..:         .::||.:.|:||.|...|       :.
  Fly   383 ENYGRCVKCNSRVLGESSG------CTAM---------DQIYHIFCFTCTDCQINL-------QG 425

  Fly   189 RPGLAANDMNELYC----LRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLG 249
            :|..|.:  .:.||    |:..:|     |..|..||.||::.|.||.:|.:.|.|..|.|...|
  Fly   426 KPFYALD--GKPYCEYDYLQTLEK-----CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDG 483

  Fly   250 HRH-YEKRGLAYCETHYHQLFGNLCFVCNQVIGGDV-------FTALNKAWCVHHFACSVCDTKM 306
            ... .:.....||.|.:|:.|...|.||.|.|..|.       ..||::::.:..:.|..|...:
  Fly   484 LLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLL 548

  Fly   307 TQKSK---FYEYDEKPVCKKCYDRFPNELRRRLRTAH 340
            :.:::   .|..|:..:||.|..:....|..|:.:.|
  Fly   549 SSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEH 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 2/8 (25%)
LIM3_PINCH 146..206 CDD:188719 13/63 (21%)
LIM4_PINCH 212..265 CDD:188720 18/53 (34%)
LIM5_PINCH 273..326 CDD:188721 15/62 (24%)
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 18/76 (24%)
LIM2_LPP 448..507 CDD:188740 20/58 (34%)
LIM3_LPP 508..575 CDD:188821 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.