DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Prickle4

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_038940411.1 Gene:Prickle4 / 316212 RGDID:1563979 Length:368 Species:Rattus norvegicus


Alignment Length:241 Identity:50/241 - (20%)
Similarity:65/241 - (26%) Gaps:114/241 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFR 107
            || |..|.:...|.:.|:|....|.:            ||                  ||..||.
  Rat   122 HT-CEKCKKLLNPGEYGVFAARAGER------------CC------------------WHRPCFA 155

  Fly   108 CQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSC 172
            ||.|.:.|.:..:.                                           ||..|   
  Rat   156 CQACGQALTNLIYF-------------------------------------------YHDGH--- 174

  Fly   173 TACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPI-EERVVTALGKHWHVE 236
                                       |||.|.|.::..|.|.||.:.| .:|...|.|:|||..
  Rat   175 ---------------------------LYCGRHHAELLRPRCPACDQLIFSQRCTEAEGRHWHEN 212

  Fly   237 HFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGG 282
            ||.|..|.:|..|.|:....|...|.:         ||......||
  Rat   213 HFCCQDCAEPLDGGRYALPGGSPCCPS---------CFARRYRSGG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 8/35 (23%)
LIM2_PINCH 82..133 CDD:188718 9/50 (18%)
LIM3_PINCH 146..206 CDD:188719 7/59 (12%)
LIM4_PINCH 212..265 CDD:188720 20/53 (38%)
LIM5_PINCH 273..326 CDD:188721 4/10 (40%)
Prickle4XP_038940411.1 PET_OEBT 1..116 CDD:193603
LIM1_Testin_like 124..181 CDD:188726 23/159 (14%)
LIM2_Testin_like 187..241 CDD:188727 20/62 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.