DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Fhl3

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001101449.1 Gene:Fhl3 / 313582 RGDID:1307180 Length:288 Species:Rattus norvegicus


Alignment Length:312 Identity:78/312 - (25%)
Similarity:123/312 - (39%) Gaps:51/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPC-----CNKCGEF--VIG---RVIKAMS 98
            ::.|.||:|    .:.::    ||||.:.|......||     .|.|.|.  :||   |.:....
  Rat     2 SEAFDCAKC----NESLY----GRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYED 58

  Fly    99 ASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI--DEEPLRFR 161
            ..:|..||||..|.:.|||..|....:..||:||.....:.     .|..|...:  ....|.:.
  Rat    59 RHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSS-----QCSACGETVMPGSRKLEYG 118

  Fly   162 GEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVV 226
            |:.:|.:.|.|:.|...|.|.:         ...|....||:.|::....|.|..|.:.:.:..|
  Rat   119 GQTWHEHCFLCSGCEQPLGSRS---------FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGV 174

  Fly   227 TALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI----------- 280
            |...:.||.|..||..|:.|..|.:...:....||...:.:||...|..|.:.|           
  Rat   175 TYRDQPWHRECLVCTGCQTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGGSGSEGAGL 239

  Fly   281 -GGDVFTALNKAWCVHH--FACSVCDTKMTQKSKFYEYDEKPVCKKCYDRFP 329
             ||...:..::.|  ||  |:|:.|.|.:..:. |....::.:|:.|....|
  Rat   240 GGGKYVSFEDRHW--HHSCFSCARCSTSLVGQG-FVPDGDQVLCQGCSQAGP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 9/34 (26%)
LIM2_PINCH 82..133 CDD:188718 19/55 (35%)
LIM3_PINCH 146..206 CDD:188719 13/61 (21%)
LIM4_PINCH 212..265 CDD:188720 15/52 (29%)
LIM5_PINCH 273..326 CDD:188721 15/66 (23%)
Fhl3NP_001101449.1 LIM <5..33 CDD:413332 11/35 (31%)
LIM1_FHL3 36..94 CDD:188807 20/57 (35%)
LIM2_FHL3 98..155 CDD:188811 14/70 (20%)
LIM3_FHL 162..213 CDD:188732 14/50 (28%)
LIM 221..284 CDD:413332 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.