DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and pxl1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_596112.1 Gene:pxl1 / 2540856 PomBaseID:SPBC4F6.12 Length:438 Species:Schizosaccharomyces pombe


Alignment Length:173 Identity:44/173 - (25%)
Similarity:70/173 - (40%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CNKC-GEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYV 145
            |:.| |....||:|.|.....|||||:|..|::.|...||...:.:..||   .....:.:.|  
pombe   258 CHSCGGSLRAGRIISASGKKLHPQCFKCDTCSQNLEHVGFYYREGKFYCH---LDYHEQFSPR-- 317

  Fly   146 CQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMG 210
            |:.|...|:::.:....:.:|..|..|..|....:...      |.:..:|:  .:|..|:|...
pombe   318 CKHCKTPIEDQAVHINNDWFHENHHFCAGCSEVFNVNI------PCIYRDDL--YWCQTCYDNKY 374

  Fly   211 IPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY 253
            ...|..||:||....|......:|.:.:.|..| ...||...|
pombe   375 AVKCKKCRKPILGISVKGSDGEYHSQCWTCGAC-NALLGDEGY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 19/51 (37%)
LIM3_PINCH 146..206 CDD:188719 10/59 (17%)
LIM4_PINCH 212..265 CDD:188720 12/42 (29%)
LIM5_PINCH 273..326 CDD:188721
pxl1NP_596112.1 LIM 258..314 CDD:278823 19/58 (33%)
LIM 318..370 CDD:259829 10/59 (17%)
LIM 378..428 CDD:259829 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3371
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.