DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Fhl1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_006257733.1 Gene:Fhl1 / 25177 RGDID:2615 Length:339 Species:Rattus norvegicus


Alignment Length:248 Identity:64/248 - (25%)
Similarity:95/248 - (38%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSAS----------W 101
            |.|..|..|.|...:.:.:||..|.:.|....|..|.:|.        |.:||.          |
  Rat    21 FDCHYCRDPLQGKKYVQKDGRHCCLKCFDKFCANTCVECR--------KPISADAKEVHYKNRYW 77

  Fly   102 HPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI--DEEPLRFRGEV 164
            |..||||..|...||...|:....:.||::|..:   |.:.|  |:.|...|  .::.:.::|.:
  Rat    78 HDTCFRCAKCLHPLASETFVSKDGKILCNKCATR---EDSPR--CKGCFKAIVAGDQNVEYKGTI 137

  Fly   165 YHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTAL 229
            :|...|:|:.|...:.:.:...|.         .:.||:.||:......|..|.:.|....:|..
  Rat   138 WHKDCFTCSNCKQVIGTGSFFPKG---------EDFYCVTCHETKFAKHCVKCNKAITSGGITYQ 193

  Fly   230 GKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGG 282
            .:.||.|.|||..|.|...|.|........||...|.......|..|...|.|
  Rat   194 DQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 9/31 (29%)
LIM2_PINCH 82..133 CDD:188718 17/60 (28%)
LIM3_PINCH 146..206 CDD:188719 11/61 (18%)
LIM4_PINCH 212..265 CDD:188720 16/52 (31%)
LIM5_PINCH 273..326 CDD:188721 4/10 (40%)
Fhl1XP_006257733.1 LIM <21..49 CDD:351770 8/27 (30%)
LIM1_FHL1 56..109 CDD:188730 17/60 (28%)
LIM2_FHL1 117..174 CDD:188808 13/65 (20%)
LIM3_FHL1 178..230 CDD:188813 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.