DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and CG30178

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster


Alignment Length:206 Identity:59/206 - (28%)
Similarity:90/206 - (43%) Gaps:31/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPG 191
            ::|..||.|    |..|.||.             .|:.||.:||:|..||..:|         |.
  Fly     4 SICCRCNEK----IWPRAVCS-------------LGKTYHPHHFTCKECGLVVD---------PK 42

  Fly   192 L--AANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYE 254
            |  |.:|  ::.|..|:.......|.|||.||.||.|.|..:.||.:.|.|..|.|..:....:|
  Fly    43 LFFAVDD--DVVCSECYLDKHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFE 105

  Fly   255 KRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKP 319
            ..|..:|:.|:.:||.:.|..|.:.|......||:..|....|.|..|..:::.: :|:..:.:|
  Fly   106 VNGYLFCKAHFRELFSSRCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAR-EFWIENGQP 169

  Fly   320 VCKKCYDRFPN 330
            :|..|....|:
  Fly   170 ICAACQTVVPS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 1/5 (20%)
LIM3_PINCH 146..206 CDD:188719 15/61 (25%)
LIM4_PINCH 212..265 CDD:188720 19/52 (37%)
LIM5_PINCH 273..326 CDD:188721 13/52 (25%)
CG30178NP_726395.1 LIM 6..61 CDD:295319 23/82 (28%)
LIM 65..116 CDD:259829 19/50 (38%)
LIM 124..171 CDD:295319 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
65.970

Return to query results.
Submit another query.