DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Prickle2

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_006506169.1 Gene:Prickle2 / 243548 MGIID:1925144 Length:937 Species:Mus musculus


Alignment Length:282 Identity:72/282 - (25%)
Similarity:101/282 - (35%) Gaps:82/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTEKI--VNSNGE------LWHTQCFVCAQCFRPFQDGIFYEFEGRKYCE--------------- 71
            |.||:  |||.||      |.|.        ..|..:.:       :||.               
Mouse   149 PEEKVPYVNSAGEKLRIKQLLHQ--------LPPHDNEV-------RYCNSLDEEEKRELKLFSN 198

  Fly    72 ------------RDFHV-LFAPCCNKCGEFVIGRVIKAMSAS-------WHPQCFRCQLCAKELA 116
                        |.|.| :....|.:||..:.|..| |:.||       |||.||.|.:|.:.|.
Mouse   199 QRKRENLGRGNVRPFP
VTMTGAICEQCGGQIKGGDI-AVFASRAGHGICWHPPCFVCTVCNELLV 262

  Fly   117 DCGFIKNQNRALCHECNAK-VKAEITGRYVCQKCHGLI-DEEPLRFRGEVYHGYHFSCTACGTEL 179
            |..:.....:..|...:|: :|..      |..|..:| .:|.....|..:|..||.|..|.|.|
Mouse   263 DLIYFYQDGKIYCGRHHA
ECLKPR------CAACDEIIFADECTEAEGRHWHMRHFCCFECETVL 321

  Fly   180 DSTAREVK-SRPGLAANDMNELYCLRCHDKMGIPICGACRR--PIEERVVTALGKHWHVEH--FV 239
            ......:| .||          ||..|.:.:....|..|.:  .|::..:|..|:|||...  |.
Mouse   322 GGQRYIMKEGRP----------YCCHCFE
SLYAEYCDTCAQHIGIDQGQMTYDGQHWHATETCFC 376

  Fly   240 CAKCEKPFLGHRHYEKRGLAYC 261
            ||.|:|..||.....|:|..:|
Mouse   377 CAHCKKSLLGRPFLPKQGQIFC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 16/84 (19%)
LIM2_PINCH 82..133 CDD:188718 18/57 (32%)
LIM3_PINCH 146..206 CDD:188719 17/61 (28%)
LIM4_PINCH 212..265 CDD:188720 18/54 (33%)
LIM5_PINCH 273..326 CDD:188721
Prickle2XP_006506169.1 PET_Prickle 118..214 CDD:193602 14/79 (18%)
LIM1_Prickle 222..280 CDD:188799 18/58 (31%)
LIM2_Prickle 285..340 CDD:188802 18/70 (26%)
LIM3_Prickle 345..403 CDD:188804 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.