DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Trip6

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_035769.1 Gene:Trip6 / 22051 MGIID:1343458 Length:480 Species:Mus musculus


Alignment Length:188 Identity:50/188 - (26%)
Similarity:74/188 - (39%) Gaps:37/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQC 105
            ::|..||||:.|....:...||..|.|.||| ..:|.....|:.|.|.::.|:::||..::||.|
Mouse   303 VFHIGCFVCSTCRAQLRGQHFYAVERRAYCE-SCY
VATLEKCSTCSEPILDRILRAMGKAYHPGC 366

  Fly   106 FRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGE------- 163
            |.|.:|.:.|....|..:....:  .|......:...|  |..|.|.|..||    |:       
Mouse   367 FTCVVCHRGLDGIPFTVDATSQI--HCIEDFHRKFAPR
--CSVCGGAIMPEP----GQEETVRIV 423

  Fly   164 -VYHGYH---FSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGAC 217
             :...:|   :.|..||..|.|                 |..|..|:...|..:|.||
Mouse   424 ALDRSFHIGCYKCEECGLLLSS-----------------EGECQGCYPLDGHILCKAC 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 14/37 (38%)
LIM2_PINCH 82..133 CDD:188718 14/50 (28%)
LIM3_PINCH 146..206 CDD:188719 15/70 (21%)
LIM4_PINCH 212..265 CDD:188720 3/6 (50%)
LIM5_PINCH 273..326 CDD:188721
Trip6NP_035769.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..84
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..257
LIM1_TRIP6 283..336 CDD:188736 13/33 (39%)
LIM 343..402 CDD:295319 15/60 (25%)
LIM3_Zyxin_like 403..465 CDD:188743 20/83 (24%)
Interaction with MAGI1 and PTPN13. /evidence=ECO:0000250 473..480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.