DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Tgfb1i1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_036008777.1 Gene:Tgfb1i1 / 21804 MGIID:102784 Length:496 Species:Mus musculus


Alignment Length:252 Identity:75/252 - (29%)
Similarity:113/252 - (44%) Gaps:31/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYV- 145
            |..|.:.:.|:|:.|:..:|||:.|.|..|:..|....|.:......|.||..:       |:. 
Mouse   263 CGSCNKPIAGQVVTALGRAWHPEHFLCSGCSTTLGGSSFFEKDGAPFCPECYFE-------RFSP 320

  Fly   146 -CQKCHGLIDEEPLRFR-----GEVYHGYHFSCTACGTEL-DSTAREVKSRPGLAANDMNELYCL 203
             |..|:     :|:|.:     |..:|..||.|.:||... :....|.:.||          ||.
Mouse   321 RCGFCN-----QPIRHKMVTALGTHWHPEHFCCVSCGEPFGEEGFHEREGRP----------YCR 370

  Fly   204 RCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQL 268
            |...::..|.|..|:.||.:..::||...||.:.|||.:|..||.|...:|..|...||.|:|..
Mouse   371 RDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECLAPFSGGSFFEHEGRPLCENHFHAQ 435

  Fly   269 FGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKCY 325
            .|:||..|...:.|...:||.:.:...||.|:.|...:| |..|.|...||.|:.|:
Mouse   436 RGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLT-KGSFQERASKPYCQPCF 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 15/50 (30%)
LIM3_PINCH 146..206 CDD:188719 17/65 (26%)
LIM4_PINCH 212..265 CDD:188720 20/52 (38%)
LIM5_PINCH 273..326 CDD:188721 17/53 (32%)
Tgfb1i1XP_036008777.1 Paxillin 4..>128 CDD:397550
LIM1_Paxillin_like 263..315 CDD:259830 16/51 (31%)
LIM2_Paxillin_like 322..373 CDD:188723 17/65 (26%)
LIM 381..433 CDD:413332 20/51 (39%)
LIM4_Leupaxin 440..491 CDD:188796 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.