DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Tes

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_997059.1 Gene:Tes / 21753 MGIID:105081 Length:419 Species:Mus musculus


Alignment Length:225 Identity:50/225 - (22%)
Similarity:73/225 - (32%) Gaps:74/225 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVI-GRVIKAMSASWHP 103
            :|||..||:|:.|.....|.|::...|:.||.|.:.....|.|..|.|.:. ....:|.:.:||.
Mouse   257 KLWHPACFICSTCGELLVDMIYFWKNGKLYCGRHY
CDSEKPRCAGCDELIFSNEYTQAENQNWHL 321

  Fly   104 QCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGY 168
            :.|.|..|...||...::...::.:|..|..|..|     .|||.||..||.|..|         
Mouse   322 KHFCCFDCDHILAGKIYVMVTDKPVCKPCYV
KNHA-----VVCQGCHNAIDPEVQR--------- 372

  Fly   169 HFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHW 233
                                                                     ||.....|
Mouse   373 ---------------------------------------------------------VTYNNFSW 380

  Fly   234 H--VEHFVCAKCEKPFLGHRHYEKRGLAYC 261
            |  .|.|:|:.|.|..:|.:.....|:.:|
Mouse   381 HASTECFLCSCCSKCLIGQKFMPVEGMVFC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 13/38 (34%)
LIM2_PINCH 82..133 CDD:188718 12/51 (24%)
LIM3_PINCH 146..206 CDD:188719 8/59 (14%)
LIM4_PINCH 212..265 CDD:188720 12/52 (23%)
LIM5_PINCH 273..326 CDD:188721
TesNP_997059.1 PET_testin 109..196 CDD:193604
LIM1_Testin 234..291 CDD:188797 13/33 (39%)
LIM2_Testin 297..352 CDD:188800 14/54 (26%)
LIM3_Testin 359..417 CDD:188803 20/118 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.