DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Lpp

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001139424.1 Gene:Lpp / 210126 MGIID:2441849 Length:613 Species:Mus musculus


Alignment Length:229 Identity:60/229 - (26%)
Similarity:90/229 - (39%) Gaps:48/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLA 193
            |..|...|..|.||      |..:         .:|:|...|:|..|..:|       :.:|..|
Mouse   417 CARCGENVVGEGTG------CTAM---------DQVFHVDCFTCIVCDVKL-------RGQPFYA 459

  Fly   194 ANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEK-----PFLGHRHY 253
            ..  .:.||..|:... :..|..|.:||.||::.|.||.:|...|.|..|.:     ||.    .
Mouse   460 VE--KKAYCEPCYINT-LEQCSVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFT----V 517

  Fly   254 EKRGLAYCETHYHQLFGNLCFVCNQVI----GGDV---FTALNKAWCVHHFACSVCDTKMTQ--K 309
            :..||.:|...:|:.|...|.||.:.|    |.:.   ..||::.:.||.:.|..|...:::  .
Mouse   518 DACGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDN 582

  Fly   310 SKFYEYDEKPVCKKCYDRFPNELRRRLRTAHEMT 343
            ...|..|...:||.|     |..|.|:.||...|
Mouse   583 QGCYPLDGHILCKTC-----NSARIRVLTAKAST 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 1/3 (33%)
LIM3_PINCH 146..206 CDD:188719 11/59 (19%)
LIM4_PINCH 212..265 CDD:188720 18/57 (32%)
LIM5_PINCH 273..326 CDD:188721 16/61 (26%)
LppNP_001139424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..259
PRK14971 <139..>240 CDD:237874
dnaA 192..>388 CDD:237605
LIM1_TRIP6 417..470 CDD:188736 17/76 (22%)
LIM 477..536 CDD:351770 20/62 (32%)
LIM 537..602 CDD:351770 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.