DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and alp-1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001023371.1 Gene:alp-1 / 177701 WormBaseID:WBGene00001132 Length:1424 Species:Caenorhabditis elegans


Alignment Length:251 Identity:62/251 - (24%)
Similarity:83/251 - (33%) Gaps:79/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AMHCTRCADGFEPTEKIVNSNGELWHTQCFVCA--QCFRPFQDGIFYEFEGRKYCERDFHVLFAP 80
            |..|..|.......  .|.:.|:.|..:.||||  .|.|...:..|.|.:|:|:||..|....||
 Worm  1248 APFCESCKQQIRGA--FVLATGKSWCPEHFVCANSSCRRRLLECGFVEEDGQKFCESCFEQHIAP 1310

  Fly    81 CCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYV 145
            .||||.:.:|...:.|:...|||.||.|..|.|...:..|...|....|.:              
 Worm  1311 RCNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFGNSAFYLEQGLPYCEQ-------------- 1361

  Fly   146 CQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMG 210
                                                              |.|.|:..:      
 Worm  1362 --------------------------------------------------DWNALFTTK------ 1370

  Fly   211 IPICGACRRPIE--ERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETH 264
               |.:||.|||  :|.|.|||..:|...|.||:|.....|...:.|.|..:|..|
 Worm  1371 ---CVSCRYPIEAGDRWVEALGNAFHSNCFTCARCNHNLEGESFFAKNGQPFCRLH 1423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/59 (31%)
LIM2_PINCH 82..133 CDD:188718 17/50 (34%)
LIM3_PINCH 146..206 CDD:188719 3/59 (5%)
LIM4_PINCH 212..265 CDD:188720 21/55 (38%)
LIM5_PINCH 273..326 CDD:188721
alp-1NP_001023371.1 PDZ_signaling 5..80 CDD:238492
DUF4749 137..>197 CDD:292558
ZM 137..162 CDD:128974
LIM_ALP_like 220..271 CDD:188746
LIM1_Enigma_like_1 1251..1304 CDD:188839 17/54 (31%)
LIM 1312..1363 CDD:295319 17/114 (15%)
LIM3_Enigma_like_1 1371..1424 CDD:188845 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.