DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and prkl-1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_741435.2 Gene:prkl-1 / 177463 WormBaseID:WBGene00022727 Length:523 Species:Caenorhabditis elegans


Alignment Length:357 Identity:89/357 - (24%)
Similarity:131/357 - (36%) Gaps:90/357 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTEKI--VNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCE----------RDFH------- 75
            |..|:  :.|.||.|..:   .::...|.||      ...:|||          |.|.       
 Worm    79 PENKVPFIGSAGEKWRQR---QSRYQLPPQD------SDVRYCEDLNAEEADTLRMFERTRKTEC 134

  Fly    76 -----VLFAPC---CNKCGEFVIGRVIKAMSA----SWHPQCFRCQLCAKELADCGFIKNQNRAL 128
                 |.:||.   |.||.:.:....|..|:|    .:||.|||||.|...|.|..:..:.|:..
 Worm   135 LGSGVVQYAP
FDTKCEKCPKRLEEGEISVMAARTGKRYHPSCFRCQTCDVLLVDLIYFAHDNQIY 199

  Fly   129 CHECNAKVKAEITGRYVCQKCHGLI-DEEPLRFRGEVYHGYHFSCTACGTEL-DSTAREVKSRPG 191
            |...:|:   ::..|  |.||..:| .:|.|...|..:|.:||.|..|...| |....:..::| 
 Worm   200 CGRHH
AE---QVKPR--CAKCDEVIFGDECLEAEGRSWHFHHFQCAQCNDVLADQKYMQRANKP- 258

  Fly   192 LAANDMNELYCLRC-HDKMGIPICGACRRPIEERV--VTALGKHWH--VEHFVCAKCEKPFLGHR 251
                     .||:| |.......|..||.......  ::....|||  .|.|.|..|.|..||.:
 Worm   259 ---------VCLK
CFHSSSSTFSCTTCRLSFSSDTPHMSQGDLHWHASAECFCCCVCSKNLLGVK 314

  Fly   252 HYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTAL--NKAWCVHHFACSVCDTKMTQKSKFYE 314
                          :...|...|...|..||:....|  ::....|.        |:||||.  :
 Worm   315 --------------YSRVGESLFC
GYQTCGGEDEELLDEDRLGSPHR--------KVTQKST--K 355

  Fly   315 YDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK 346
            ....|...:...|.|:.:::.|.|.  ||::|
 Worm   356 VVRIPASPRVAPRHPHVIQQNLTTT--MTIQK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 15/72 (21%)
LIM2_PINCH 82..133 CDD:188718 18/54 (33%)
LIM3_PINCH 146..206 CDD:188719 18/62 (29%)
LIM4_PINCH 212..265 CDD:188720 13/56 (23%)
LIM5_PINCH 273..326 CDD:188721 12/54 (22%)
prkl-1NP_741435.2 PET_Prickle 48..144 CDD:193602 15/73 (21%)
LIM1_Testin_like 149..204 CDD:188726 18/54 (33%)
LIM2_Testin_like 210..262 CDD:188727 17/63 (27%)
LIM 283..324 CDD:295319 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.