DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Fhl3

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_006502829.1 Gene:Fhl3 / 14201 MGIID:1341092 Length:303 Species:Mus musculus


Alignment Length:320 Identity:80/320 - (25%)
Similarity:125/320 - (39%) Gaps:52/320 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPC-----CNKCGEF--VIG--- 91
            |.|....::.|.||:|    .:.::    ||||.:.|......||     .|.|.|.  :||   
Mouse     9 SLGTATMSEAFDCAKC----NESLY----GRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDS 65

  Fly    92 RVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI--D 154
            |.:......:|..||||..|.:.|||..|....:..||:||.....:.     .|..|...:  .
Mouse    66 RELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSS-----QCSACGETVMPG 125

  Fly   155 EEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRR 219
            ...|.:.|:.:|.:.|.|:.|...|.|.:         ...|....||:.|::....|.|..|.:
Mouse   126 SRKLEYGGQTWHEHCFLCSGCEQPLGSRS---------FVPDKGAHYCVPCYENKFAPRCARCSK 181

  Fly   220 PIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI---- 280
            .:.:..||...:.||.|..||..|:.|..|.:...:....||...:.:||...|..|.:.|    
Mouse   182 TLTQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGGS 246

  Fly   281 ---------GGDVFTALNKAWCVHH--FACSVCDTKMTQKSKFYEYDEKPVCKKCYDRFP 329
                     ||...:..::.|  ||  |:|:.|.|.:..:. |....::.:|:.|....|
Mouse   247 GGGEGAGLGGGKYVSFEDRHW--HHSCFSCARCSTSLVGQG-FVPDGDQVLCQGCSQAGP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 11/41 (27%)
LIM2_PINCH 82..133 CDD:188718 19/55 (35%)
LIM3_PINCH 146..206 CDD:188719 13/61 (21%)
LIM4_PINCH 212..265 CDD:188720 15/52 (29%)
LIM5_PINCH 273..326 CDD:188721 15/67 (22%)
Fhl3XP_006502829.1 LIM <19..47 CDD:351770 11/35 (31%)
LIM1_FHL3 50..108 CDD:188807 20/57 (35%)
LIM2_FHL3 112..169 CDD:188811 14/70 (20%)
LIM3_FHL 176..227 CDD:188732 14/50 (28%)
LIM 235..299 CDD:351770 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.