DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and WTIP

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_011524754.1 Gene:WTIP / 126374 HGNCID:20964 Length:472 Species:Homo sapiens


Alignment Length:239 Identity:55/239 - (23%)
Similarity:86/239 - (35%) Gaps:90/239 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLF------A 79
            |.:|..|....::...:.|.|:||.||.|..|.|..:...||....:.||:.||  |:      |
Human   225 CIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDF--LYSGFQQTA 287

  Fly    80 PCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRY 144
            ..|:.||..::..:::|:..|:||.||||                  ::|:||            
Human   288 DKCSVCGHLIMEMILQALGKSYHPGCFRC------------------SVCNEC------------ 322

  Fly   145 VCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKM 209
                    :|..|.....|                                  |.:||:|.:..:
Human   323 --------LDGVPFTVDVE----------------------------------NNIYCVRDYHTV 345

  Fly   210 GIPICGACRRPI------EERV-VTALGKHWHVEHFVCAKCEKP 246
            ..|.|.:|.|||      |..: |.::.:.:||   .|..||.|
Human   346 FAPKCASCARPILPAQGCETTIRVVSMDRDYHV---ACYHCEDP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 19/63 (30%)
LIM2_PINCH 82..133 CDD:188718 13/50 (26%)
LIM3_PINCH 146..206 CDD:188719 7/59 (12%)
LIM4_PINCH 212..265 CDD:188720 14/42 (33%)
LIM5_PINCH 273..326 CDD:188721
WTIPXP_011524754.1 LIM1_Ajuba_like 225..278 CDD:188738 16/52 (31%)
LIM2_Ajuba_like 290..342 CDD:188741 21/123 (17%)
LIM 350..404 CDD:295319 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.