DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Zyx

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_006236450.1 Gene:Zyx / 114636 RGDID:620698 Length:666 Species:Rattus norvegicus


Alignment Length:256 Identity:58/256 - (22%)
Similarity:84/256 - (32%) Gaps:106/256 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPC---- 81
            |.:|:......:..|.:.|:|:|..||.|.||.:..|...||..||..|||        .|    
  Rat   478 CGKCSQPLARAQPAVRALGQLFHITCFTCHQCQQQLQGQQFYSLEGAPYCE--------GCYTDT 534

  Fly    82 ---CNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGR 143
               ||.||:.:..|:::|...::||.||.|.:||..|....||.:|                   
  Rat   535 LEKCNTCGQPITDRMLRATGKAYHPHCFTCVVCACPLEGTSFIVDQ------------------- 580

  Fly   144 YVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDK 208
                                                                 .|:.:|:..:.|
  Rat   581 -----------------------------------------------------ANQPHCVPDYHK 592

  Fly   209 MGIPICGACRRPI------EERV-VTALGKHWHVEHFVCAKCEK------------PFLGH 250
            ...|.|..|..||      :|.| |.||.|::|::.:.|..|.|            |..||
  Rat   593 QYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKALSIEADDNGCFPLDGH 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 19/57 (33%)
LIM2_PINCH 82..133 CDD:188718 17/50 (34%)
LIM3_PINCH 146..206 CDD:188719 2/59 (3%)
LIM4_PINCH 212..265 CDD:188720 18/58 (31%)
LIM5_PINCH 273..326 CDD:188721
ZyxXP_006236450.1 LIM1_Zyxin 445..531 CDD:188735 19/60 (32%)
LIM2_Zyxin 538..597 CDD:188739 20/130 (15%)
LIM3_Zyxin 598..664 CDD:188819 17/56 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.