DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fhl5

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001116957.1 Gene:fhl5 / 100144736 XenbaseID:XB-GENE-1002465 Length:282 Species:Xenopus tropicalis


Alignment Length:296 Identity:72/296 - (24%)
Similarity:122/296 - (41%) Gaps:44/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CFVCAQCFRPFQDGIFYEFEGRK--------YCERDFHVLFAPCCNKCGEFV--IGRVIKAMSAS 100
            ||.|.:           ...|:|        ||.:.|:.|||..|.:|.:.:  ..:.:....:.
 Frog     8 CFHCKE-----------SLYGKKYTLKDDIPYCIKCF
NSLFANLCERCKKPIECNSKDLAYKDSH 61

  Fly   101 WHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI--DEEPLRFRGE 163
            ||..||:|..|...|.:..|.......||.||   ...|.:.:  |..|...|  ....:.:.|.
 Frog    62 WHETCFKCDKCDHSLVEKPFAAKDELLLCIEC---YS
TEYSSK--CFGCRATIMPGSRKMEYNGS 121

  Fly   164 VYHGYHFSCTACGTELDSTARE-VKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVT 227
            .:|...|.|.:|        || |.::|.:...  :::||:.|::|.....|.:||:.|.:..::
 Frog   122 NWHETCFVCQSC--------REPVGNKPFIPKE--SKIYCMPCY
EKQFANQCKSCRKAITKGGLS 176

  Fly   228 ALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI---GGDVFTAL- 288
            ...:.||.|.|||..|:|..:|.:...:....||...:..|:...|..|.:.|   ||..:.:. 
 Frog   177 FQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCF
DNLYAKKCAACAKPITGQGGAKYISFE 241

  Fly   289 NKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKC 324
            ::.|....|.|:.| :|.....||:..::..:|..|
 Frog   242 DRQWHSDCFTCAKC-SKSLVGEKFHTNEDDVLCPSC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 9/40 (23%)
LIM2_PINCH 82..133 CDD:188718 13/52 (25%)
LIM3_PINCH 146..206 CDD:188719 14/62 (23%)
LIM4_PINCH 212..265 CDD:188720 15/52 (29%)
LIM5_PINCH 273..326 CDD:188721 14/56 (25%)
fhl5NP_001116957.1 LIM <6..33 CDD:351770 7/35 (20%)
LIM1_FHL 37..95 CDD:188729 16/60 (27%)
LIM2_FHL 102..155 CDD:188731 14/62 (23%)
LIM3_FHL 163..214 CDD:188732 15/50 (30%)
LIM4_FHL 222..277 CDD:188733 14/56 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.