DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and prickle2

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_031757102.1 Gene:prickle2 / 100126208 XenbaseID:XB-GENE-482891 Length:893 Species:Xenopus tropicalis


Alignment Length:276 Identity:66/276 - (23%)
Similarity:88/276 - (31%) Gaps:91/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAMHCTRCADGFEPTEKIV----NSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVL 77
            ||: |.:|.......:..|    ..:|..||.|||||..|.....|.|::..:|:.||.|.....
 Frog   183 GAI-CEQCGGQINGGDMAVFASRAGHGVCWHPQCFVCIICNELLVDLIYFYQDGKIYCGRHHAEC 246

  Fly    78 FAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITG 142
            ..|.|..|.|.:                         .||             ||     .|..|
 Frog   247 LKPRCAACDEII-------------------------FAD-------------EC-----TEAEG 268

  Fly   143 RYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVK-SRPGLAANDMNELYCLRCH 206
            |:                    :|..||.|..|.|.|......:| .||          ||..|.
 Frog   269 RH--------------------WHMKHFCCFECETVLGGQRYIMKEGRP----------YCCNCF 303

  Fly   207 DKMGIPICGACRR--PIEERVVTALGKHWHVEH--FVCAKCEKPFLGHRHYEKRGLAYCETHYHQ 267
            :.:....|..|.:  .|::..:|..|:|||...  |.||.|:|..||.....|:|..:|      
 Frog   304 ESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATENCFCCAHCKKSLLGRPFLPKQGQIFC------ 362

  Fly   268 LFGNLCFVCNQVIGGD 283
              ...|.|.....|.|
 Frog   363 --SRACSVGEDPNGSD 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/61 (30%)
LIM2_PINCH 82..133 CDD:188718 6/50 (12%)
LIM3_PINCH 146..206 CDD:188719 12/60 (20%)
LIM4_PINCH 212..265 CDD:188720 18/56 (32%)
LIM5_PINCH 273..326 CDD:188721 4/11 (36%)
prickle2XP_031757102.1 PET_Prickle 82..178 CDD:193602
LIM1_Prickle 186..244 CDD:188799 18/57 (32%)
LIM2_Prickle 249..304 CDD:188802 24/127 (19%)
LIM3_Prickle 309..367 CDD:188804 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.