DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and lmcd1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_012815919.1 Gene:lmcd1 / 100124907 XenbaseID:XB-GENE-966902 Length:352 Species:Xenopus tropicalis


Alignment Length:149 Identity:39/149 - (26%)
Similarity:64/149 - (42%) Gaps:18/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 ELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAK 242
            |.:.||:|        |.:..|.:|..|..    |:.........||  ....|.||...|:|.:
 Frog   213 ETNGTAKE--------AFEKTEYFCEMCQQ----PLSRDAPAVYAER--AGFDKQWHPACFMCCQ 263

  Fly   243 CEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKA-WCVHHFACSVCDTKM 306
            |.:|.:...::.:....:|..||.:.....|..|:|:|..:.:..::.. |..|||:|:.||  .
 Frog   264 CREPLVNLIYFWRNNSLWCGRHYCESERPRCAGCDQMIFSEDYEQVDSGFWHRHHFSCTDCD--Q 326

  Fly   307 TQKSKFYEYDE-KPVCKKC 324
            |...|.|..|: :|:|..|
 Frog   327 TLSGKPYVLDKAQPLCDLC 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718
LIM3_PINCH 146..206 CDD:188719 7/27 (26%)
LIM4_PINCH 212..265 CDD:188720 11/52 (21%)
LIM5_PINCH 273..326 CDD:188721 18/54 (33%)
lmcd1XP_012815919.1 PET_testin 111..198 CDD:193604
LIM1_Testin_like 229..286 CDD:188726 13/62 (21%)
LIM 292..345 CDD:351770 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.