DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and tgfb1i1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_012825390.2 Gene:tgfb1i1 / 100038241 XenbaseID:XB-GENE-493249 Length:503 Species:Xenopus tropicalis


Alignment Length:307 Identity:86/307 - (28%)
Similarity:126/307 - (41%) Gaps:79/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKC 85
            |.|...|     ::|.:.|..||.:.||||.|........|:|.:||.|||:|:.:|:||.|..|
 Frog   273 CQRPIAG-----QVVTALGHTWHPEHFVCAHCHALIGTTNFFEKDGRPYCEKDYFMLYAPRCALC 332

  Fly    86 GEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCH 150
            ...::..::.|:..:|||:.|.|::|.|.:.:.||         ||.:                 
 Frog   333 ELPIVQNMVTALGCTWHPEHFCCKVCKKPIGEEGF---------HEKD----------------- 371

  Fly   151 GLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICG 215
                                                           .|.||...:.::...:|.
 Frog   372 -----------------------------------------------GEQYCSDDYFRLFGAVCA 389

  Fly   216 ACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI 280
            .|...::|..::|||..||.:.|||..|..||:....:|..||..||||||...|:||..|.|.|
 Frog   390 GCSEAVKESYISALGGLWHPQCFVCHVCHTPFINGSFFEHEGLPLCETHYHSRRGSLCAGCEQPI 454

  Fly   281 GGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKCYDR 327
            .|...||:.|.:...|..|:.| .:...|..|.|:|.||.|:.||.|
 Frog   455 TGRCVTAMGKKFHPQHLNCTFC-LRQLNKGTFREHDGKPYCQACYAR 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 21/57 (37%)
LIM2_PINCH 82..133 CDD:188718 14/50 (28%)
LIM3_PINCH 146..206 CDD:188719 3/59 (5%)
LIM4_PINCH 212..265 CDD:188720 20/52 (38%)
LIM5_PINCH 273..326 CDD:188721 19/52 (37%)
tgfb1i1XP_012825390.2 Paxillin <61..>117 CDD:397550
LIM1_Paxillin_like 270..322 CDD:259830 20/53 (38%)
LIM2_Paxillin_like 329..380 CDD:188723 17/123 (14%)
LIM3_Paxillin_like 388..440 CDD:188724 21/51 (41%)
LIM4_Paxillin_like 447..498 CDD:188725 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.