DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7352 and Mns1

DIOPT Version :9

Sequence 1:NP_649795.1 Gene:CG7352 / 40997 FlyBaseID:FBgn0037581 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001007753.1 Gene:Mns1 / 363093 RGDID:1549718 Length:498 Species:Rattus norvegicus


Alignment Length:438 Identity:118/438 - (26%)
Similarity:219/438 - (50%) Gaps:60/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KLQYDLEE-VSRSQELSKVSPITRDFIEEAAMTQEMQDLKRAEFVERKRRQQLRRDCEELRDLAE 106
            :.:.|:|| |.:::|..::.  .|...:|..:..|:..||.....:.|.|||:|.:..|||:|.:
  Rat    64 QFELDMEEAVQKAEENKRMR--DRQLEQEERLANELARLKHESLKDEKMRQQVRENSIELRELEQ 126

  Fly   107 QLRLAAISRDIAENLEEKKRRRQLDIKLEAAEVSQERCLLEVRQR-EKEVALKEEQRRLRES--- 167
            :|:.|.::::.|..:.||...:...:|.: ||:  ||.::|..:| .||..:|:|:|....:   
  Rat   127 KLKAAYMNKERAAQIVEKDVIKYEQMKRD-AEI--ERIMMEEHKRLLKEENVKQEKRDKERAQYY 188

  Fly   168 --LAEQMEENRRRRLQEHAQVMNDRELSLLMQKQIQEEDRAQELEAQRKKLQKRQDMLRSIKENQ 230
              |.:|:|:..||:.:.:.|::.::.:...:.::|.|||   :||.| :||:||..:.:.|||.|
  Rat   189 VDLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEED---QLERQ-QKLEKRNAIQKYIKEFQ 249

  Fly   231 ELREWQRAQYNQELSDLVQKQSDMERRKLQLEAERQEIQRKKQEISIRLGQQVLEIENKKRHRDN 295
            ..::..|.:..:|:.:        |.||: ||..:.:.||:.:.::     :|.|.|.|:..|.|
  Rat   250 RAQDLWRQKKREEMEE--------ENRKI-LEFAKIQEQREGERMA-----RVQESEEKRVQRQN 300

  Fly   296 LLLDLLEAEYTAKSD-ERYRQQMQQEQMS-----------RQRTRQELDRYRQEVKHR------- 341
            ||:..||.....:.| ||.||::..|:.:           .||.|::.|| :|:.|.:       
  Rat   301 LLIQKLEETLRQRDDLERVRQELYLEEYAEFIKLKMKEEVEQRLRKQRDR-KQDFKDQMALREVL 364

  Fly   342 ----KMAEMQMKRAEMATRQEEAPDTIN-QNSEKQLDEYRRRRAHGASLLAMIEDNHRKRAEATA 401
                |..|...|:|.:|...|:  |.|. .|::||   ..::..|..::..:||:...:......
  Rat   365 LQAAKEEEEAFKKAMLAKFAED--DRIELMNAQKQ---RMKQLEHKRAVEKLIEERRNQFLADKQ 424

  Fly   402 ENVQYFDMKAKIDAEQEERIKQERLAMLSQVPSSVLRYLPKHVLKSTD 449
            ..::...::.:......|.|::|||.:|.:..|.:|.||||.|.|..|
  Rat   425 RELEELQLQQRRQGCINEIIEEERLRLLKEHASKLLGYLPKGVFKKED 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7352NP_649795.1 TPH 97..439 CDD:290579 96/371 (26%)
Mns1NP_001007753.1 TPH 117..462 CDD:290579 96/371 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51916
OrthoDB 1 1.010 - - D449210at33208
OrthoFinder 1 1.000 - - FOG0008162
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104986
Panther 1 1.100 - - LDO PTHR19265
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.