DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7352 and Mns1

DIOPT Version :9

Sequence 1:NP_649795.1 Gene:CG7352 / 40997 FlyBaseID:FBgn0037581 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_036010534.1 Gene:Mns1 / 17427 MGIID:107933 Length:550 Species:Mus musculus


Alignment Length:440 Identity:114/440 - (25%)
Similarity:227/440 - (51%) Gaps:64/440 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KLQYDLEEVSRSQELSKVSPITRDFIEEAAMTQEMQDLKRAEFVERKRRQQLRRDCEELRDLAEQ 107
            :.:.|:||..:..|.:|:.. .|...:|..:..|:..||.....::|.|||:|.:..|||:|.::
Mouse   123 QFELDMEEAIQKAEANKMLR-DRQLEQEERLANELARLKHESLKDKKMRQQVRENSIELRELEQK 186

  Fly   108 LRLAAISRDIAENLEEKKRRRQLDIKLEAAEVSQERCLLEVRQR-EKEVALKEEQRRLRES---- 167
            |:.|.::::.|..:.||...:...:|.: ||:  ||.::|...| .||.:.|:|:|....:    
Mouse   187 LKAAYMNKERAAQIVEKDAMKYEQMKRD-AEI--ERIMMEEHDRLLKEESAKQERRNKERAQYYL 248

  Fly   168 -LAEQMEENRRRRLQEHAQVMNDRELSLLMQKQIQEEDRAQELEAQRKKLQKRQDMLRSIKENQE 231
             |.:|:|:..||:.:.:.|::.::.:...:.::|.|||:.:    :::||:|:..:.:.|:|.|.
Mouse   249 DLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQVE----RQQKLEKKNAIQKYIEEFQR 309

  Fly   232 LREWQRAQYNQELSDLVQKQSDMERRKLQLEAERQEIQRKKQEISIRLGQQVLEIENKKRHRDNL 296
            .:::.|.:..:|:.:        |.||:...|..|| ||:.:.::     :|.|||.|:..|.||
Mouse   310 AQDFWRQKKREEMEE--------ENRKIIEFANIQE-QREGERMA-----RVHEIEEKRVQRQNL 360

  Fly   297 LLDLLEAEYTAKSD-ERYRQQMQQEQMS---RQRTRQELD-RYRQEVKHRKMAEMQMKRAEM--- 353
            |:..||.....:.| |:.||::.||:.:   :.:.::|.: |.|::.:.::..|.||...|:   
Mouse   361 LMKQLEETLRQRDDLEQVRQELYQEEQAEIIKLKVKEEAELRLRRQREMKQDFEDQMALKELILQ 425

  Fly   354 ATRQEE------------APDTIN-QNSEKQLDEYRRRRAHGASLLAMIEDNHRKRAEATAENVQ 405
            |.::||            ..|.|. .|::||   ..::..|..::..:||:   :|::..|:..:
Mouse   426 AAKEEEETFKKAMLAKFAEDDRIELMNAQKQ---RMKQLEHKRAVEKLIEE---RRSQFLADKQR 484

  Fly   406 YFDMKAKIDAEQ------EERIKQERLAMLSQVPSSVLRYLPKHVLKSTD 449
            ..:   ::..:|      .|.|::|||.:|.:..:.:|.||||.|.|..|
Mouse   485 ELE---ELQLQQRRQGCINEIIEEERLRLLKEHAAKLLGYLPKGVFKRED 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7352NP_649795.1 TPH 97..439 CDD:290579 92/374 (25%)
Mns1XP_036010534.1 TPH 173..524 CDD:404709 95/380 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JVC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51916
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008162
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104986
Panther 1 1.100 - - LDO PTHR19265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.