DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7AL and COX7A

DIOPT Version :10

Sequence 1:NP_649793.1 Gene:COX7AL / 40995 FlyBaseID:FBgn0037579 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster


Alignment Length:71 Identity:27/71 - (38%)
Similarity:43/71 - (60%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IREFRNSAALKYAAAAAAAPKTRPGKVPPKMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLC 89
            :|.|..:|..:    :||.||.:..|...::.|:::.||..:..|:||||..:||:|||:|..|.
  Fly    18 VRSFATTAGRR----SAAVPKDQIEKGYFEIRKVQEHFQKKDGKPVFLKGSVVDNVLYRVTVALA 78

  Fly    90 FLGIGG 95
            .:||||
  Fly    79 LVGIGG 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ALNP_649793.1 Cyt_c_Oxidase_VIIa 51..105 CDD:238468 19/45 (42%)
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 19/45 (42%)

Return to query results.
Submit another query.