DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7AL and Cox7a2

DIOPT Version :10

Sequence 1:NP_649793.1 Gene:COX7AL / 40995 FlyBaseID:FBgn0037579 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_034075.2 Gene:Cox7a2 / 12866 MGIID:1316715 Length:83 Species:Mus musculus


Alignment Length:74 Identity:28/74 - (37%)
Similarity:38/74 - (51%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RNSAALKYAAAAAAAPKTR---PGKVPPKMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLCF 90
            ||..||:..|....:..:|   ..|||.|    :|.||.||.:|:.||||:.|.:|||.|..|..
Mouse     3 RNLLALRQIAQRTISTTSRRHFENKVPEK----QKLFQEDNGMPVHLKGGASDALLYRATMALTL 63

  Fly    91 LGIGGDVWL 99
            .|....::|
Mouse    64 GGTAYAIYL 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ALNP_649793.1 Cyt_c_Oxidase_VIIa 51..105 CDD:238468 21/49 (43%)
Cox7a2NP_034075.2 Cyt_c_Oxidase_VIIa 24..78 CDD:238468 22/53 (42%)

Return to query results.
Submit another query.