DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7AL and Cox7a1

DIOPT Version :10

Sequence 1:NP_649793.1 Gene:COX7AL / 40995 FlyBaseID:FBgn0037579 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001399200.1 Gene:Cox7a1 / 12865 MGIID:1316714 Length:89 Species:Mus musculus


Alignment Length:45 Identity:24/45 - (53%)
Similarity:32/45 - (71%) Gaps:3/45 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLCFLGIGGDVW 98
            ::.:.:|.||||||||:.||||.|||:|||||..|.   :||..:
Mouse    34 RVAEKQKLFQADNDLPVHLKGGGMDNVLYRLTMTLT---LGGTAY 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ALNP_649793.1 Cyt_c_Oxidase_VIIa 51..105 CDD:238468 24/45 (53%)
Cox7a1NP_001399200.1 Cyt_c_Oxidase_VIIa 31..85 CDD:238468 24/45 (53%)

Return to query results.
Submit another query.