DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9601 and AT3G14890

DIOPT Version :9

Sequence 1:NP_649792.3 Gene:CG9601 / 40994 FlyBaseID:FBgn0037578 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_188107.3 Gene:AT3G14890 / 820718 AraportID:AT3G14890 Length:694 Species:Arabidopsis thaliana


Alignment Length:303 Identity:101/303 - (33%)
Similarity:147/303 - (48%) Gaps:64/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SLKVLGVNPCGVNGL---MLMQNGEREL-----------KH---GDLVE----IVYGRHQF---- 113
            :||.| |..||...|   |...|.:.|.           ||   |::||    :...:.|.    
plant   401 ALKEL-VQQCGKQTLVDKMDEDNDDTEAKIKLTEETNKRKHSEVGEMVEEDESLTKAKQQMAKTH 464

  Fly   114 EVVFNPPPEYDKEKAEPLSTTLSPSEKSERW-DSSGNGKLVIFTSV-------GVKGSEKIAGYD 170
            :|..:......:.:||   .|||.|:..::: |::...|...|.:|       |:..|||||.:|
plant   465 KVNMSESTSQVEVEAE---ITLSASDVKDKYRDANLLPKWKAFETVIFLERDDGLNDSEKIAAFD 526

  Fly   171 MDGTIIKTKSGLVFPKNTDDWQIIFPEVPEKLKNLHKDGFKICLFTNQGGIARGKINLD---DFK 232
            .||.:.||...:|   ..|.|.:::|.:||||::||..|:|:.:|||:..|.|.|....   |.|
plant   527 FDGCLAKTSVKIV---GADAWSLMYPSIPEKLQSLHDQGYKLVIFTNESNIDRWKNKRQAAVDSK 588

  Fly   233 V-KIKHIVAKLGVPIQVFIAIG----------DGFYRKPLTGMWQHLKSEMNDGVEIQEDRCFFV 286
            : ::...:.::.||||||||.|          |..||||..||||.:|...|.|:.|..|:.|:|
plant   589 IGRLNSFIERVKVPIQVFIACGVSSSGGKGGKDDLYRKPKAGMWQLMKKHFNSGIAIDMDKSFYV 653

  Fly   287 GDAAGRPETGKGATKRRKDHSLVDRLFAANVGISFYTPEVHFL 329
            |||||          |:.|||..|..||...|:.|:|||.:|:
plant   654 GDAAG----------RKMDHSDADIKFAQASGLKFFTPEEYFI 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9601NP_649792.3 PNK-3'Pase 9..522 CDD:130724 101/303 (33%)
FHA 26..115 CDD:238017 16/65 (25%)
HAD_like 170..288 CDD:119389 50/131 (38%)
NK 367..>440 CDD:302627
AT3G14890NP_188107.3 zf-PARP 53..126 CDD:279039
zf-PARP 176..240 CDD:279039
zf-PARP 331..404 CDD:279039 1/2 (50%)
PNK3P 521..685 CDD:285808 70/176 (40%)
HAD_like 522..679 CDD:119389 65/169 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1768
eggNOG 1 0.900 - - E1_COG0241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004625
OrthoInspector 1 1.000 - - oto3502
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12083
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3825
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.