DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9601 and APTX

DIOPT Version :9

Sequence 1:NP_649792.3 Gene:CG9601 / 40994 FlyBaseID:FBgn0037578 Length:523 Species:Drosophila melanogaster
Sequence 2:XP_016870320.1 Gene:APTX / 54840 HGNCID:15984 Length:423 Species:Homo sapiens


Alignment Length:324 Identity:80/324 - (24%)
Similarity:130/324 - (40%) Gaps:93/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VAARICTLKPTEPEHHSIHLTAGENFV-GRSRETGIRDSKCSKRQIQLQVDLKKAVVSLKVLGVN 81
            |..|:|.|...:..|..|.|...|..| ||..||.|.|.|||::|:||:.:..|..|.:|.:|||
Human    14 VMMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQLKAECNKGYVKVKQVGVN 78

  Fly    82 PCGVNGLMLMQNGERELKHGDLVEIVYGRHQFEVVFNPPPEYDKEKAEPLSTTLSPSEKSERWDS 146
            |..::.:::.::.|.:|:.|.::.:|...:.:.|      |:::|...|...|....::|...||
Human    79 PTSIDSVVIGKDQEVKLQPGQVLHMVNELYPYIV------EFEEEAKNPGLETHRKRKRSGNSDS 137

  Fly   147 ------------------SGNGKLVI----------------FTSVGVKGS---EKIAGY-DMDG 173
                              |.:|:..:                ..|.|:|.|   .|:..| |...
Human   138 IERDAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESLGHWSQGLKISMQDPKMQVYKDEQV 202

  Fly   174 TIIKTKSGLVFPKNTDDWQIIFP------------EVPEKLKNLHKDGFKICLFTNQGGIARGKI 226
            .:||.|    :||....| ::.|            |..|.||::|..|.|:.:            
Human   203 VVIKDK----YPKARYHW-LVLPWTSISSLKAVAREHLELLKHMHTVGEKVIV------------ 250

  Fly   227 NLDDF--KVKIKHIVAKLGVPIQVFIAIGDGFYRKPLTGMWQH-------LKSEMND---GVEI 278
               ||  ..|::..:....:|....|.:   |...|.||:.|.       |:|| ||   |:|:
Human   251 ---DFAGSSKLRFRLGYHAIPSMSSIRV---FCGPPETGILQGQISRPNLLESE-NDTREGLEM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9601NP_649792.3 PNK-3'Pase 9..522 CDD:130724 80/324 (25%)
FHA 26..115 CDD:238017 28/89 (31%)
HAD_like 170..288 CDD:119389 32/133 (24%)
NK 367..>440 CDD:302627
APTXXP_016870320.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10908
eggNOG 1 0.900 - - E1_COG0241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.