DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9601 and aptx

DIOPT Version :9

Sequence 1:NP_649792.3 Gene:CG9601 / 40994 FlyBaseID:FBgn0037578 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_999894.1 Gene:aptx / 405797 ZFINID:ZDB-GENE-040628-2 Length:324 Species:Danio rerio


Alignment Length:226 Identity:60/226 - (26%)
Similarity:95/226 - (42%) Gaps:66/226 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ICTL-------KPTEPEHHSIHLTAGENFVGRSRETGIRDSKCSKRQIQLQVDLKKAVVSLKVLG 79
            :|.|       ||.| .||...:|     :||..:|.|:|.|||:.|::|:.|..:..|::|.||
Zfish     3 VCLLVSEDNSHKPIE-LHHQQSVT-----LGRGPDTKIKDKKCSREQVELRADCNRGFVTVKQLG 61

  Fly    80 VNPCGVNGLMLMQNGERELKHGDLVEIVYGRHQFEVVF--------------------------- 117
            |||..|:.:::.:..:..:|.|..:.:|..::.:.|.|                           
Zfish    62 VNPTLVDDVVVGKGNQVSIKPGQSLYMVNQQYPYSVKFTEDTSRSKPSKRAQQIQSPTKTTADVS 126

  Fly   118 -NPPPEYDKEKAEPLSTTLSPSEKSERWDSSGNGKLVIFTSVGVKGS---EKIAGYDMDG-TIIK 177
             :|||        |..||....||||   |:|:      .|.|:|.|   .|:..|..|. .:||
Zfish   127 DSPPP--------PKKTTPPAGEKSE---SAGH------WSQGLKASMQDPKMQVYKDDSVVVIK 174

  Fly   178 TKSGLVFPKNTDDWQIIFPEVPEKLKNLHKD 208
            .|    :||....|.::..:....||.|..:
Zfish   175 DK----YPKARYHWLVLPWQSISSLKALRSE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9601NP_649792.3 PNK-3'Pase 9..522 CDD:130724 60/226 (27%)
FHA 26..115 CDD:238017 28/88 (32%)
HAD_like 170..288 CDD:119389 10/40 (25%)
NK 367..>440 CDD:302627
aptxNP_999894.1 FHA 5..98 CDD:238017 29/98 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..160 16/76 (21%)
aprataxin_related 147..247 CDD:238609 17/65 (26%)
Interaction with DNA substrate. /evidence=ECO:0000250|UniProtKB:Q7Z2E3 175..179 1/7 (14%)
Interaction with DNA substrate. /evidence=ECO:0000250|UniProtKB:Q7Z2E3 237..238
Histidine triad motif 240..244
zf-C2HE 266..321 CDD:292895
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11122
eggNOG 1 0.900 - - E1_COG0241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.