DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9601 and Aptx

DIOPT Version :9

Sequence 1:NP_649792.3 Gene:CG9601 / 40994 FlyBaseID:FBgn0037578 Length:523 Species:Drosophila melanogaster
Sequence 2:XP_017448660.1 Gene:Aptx / 259271 RGDID:628740 Length:343 Species:Rattus norvegicus


Alignment Length:232 Identity:64/232 - (27%)
Similarity:107/232 - (46%) Gaps:52/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RICTLKPTEPEHHSI---HLTAGENFVGRSRETGIRDSKCSKRQIQLQVDLKKAVVSLKVLGVNP 82
            |:|.|...:..|..|   ||.|  ..:|||.||.|.|.|||::|:||:.:..|..|::|.:||||
  Rat    16 RVCWLVRQDCWHQRIKLPHLEA--VVIGRSPETKITDKKCSRQQVQLKAECNKRYVNVKQMGVNP 78

  Fly    83 CGVNGLMLMQNGERELKHGDLVEIVYGRH----QFEVVFNPP---------PEYDKEK------A 128
            ..::.:::.::.|.:|..|.::.:|...:    :||.|...|         |:.|.::      |
  Rat    79 TSIDEVVIGKDREMKLLPGQVLHMVNELYPYMVEFEEVAESPNVTQRKRKRPDCDSQEMEAEAGA 143

  Fly   129 EPLSTTLSP---SEKSERWDSSGNGKLVIFTSVGVKGS---EKIAGY-DMDGTIIKTKSGLVFPK 186
            .|...::||   ...:.:.:|.|:      .|.|:|.|   .|:..| |....:||.|    :||
  Rat   144 SPSQCSVSPKTGKHGAAKEESLGH------WSQGLKISMKDPKMQVYKDDQVVVIKDK----YPK 198

  Fly   187 NTDDW-----------QIIFPEVPEKLKNLHKDGFKI 212
            ....|           :::..|..|.||::|..|.|:
  Rat   199 ARHHWLVLPWASISSLKVVTSEHLELLKHMHAVGEKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9601NP_649792.3 PNK-3'Pase 9..522 CDD:130724 64/232 (28%)
FHA 26..115 CDD:238017 30/95 (32%)
HAD_like 170..288 CDD:119389 14/54 (26%)
NK 367..>440 CDD:302627
AptxXP_017448660.1 FHA <38..112 CDD:238017 24/73 (33%)
aprataxin_related 165..266 CDD:238609 21/81 (26%)
zf-C2HE 285..341 CDD:292895
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10742
eggNOG 1 0.900 - - E1_COG0241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.