DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and ARL3

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_015274.1 Gene:ARL3 / 856056 SGDID:S000005972 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:66/175 - (37%)
Similarity:104/175 - (59%) Gaps:9/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KEREMRILLLGLDNAGKTTILKRFNGE------PIDTISPTLGFNIKTLE-HNGYTLNMWDVGGQ 70
            |:.:..||:||||||||||.|:....|      .::.|.||:|.|:.|:. .:...|..||||||
Yeast    14 KKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQ 78

  Fly    71 KSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSS 135
            :||||.|..|:....|::::|||:||.||:.|...||.::.:|.:.|..:|:|.||||....:..
Yeast    79 ESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEV 143

  Fly   136 NEIKEILH--LEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAK 178
            .:|||:.:  .|.|:.....|..:||:|||.:..:::|:|..:.:
Yeast   144 QDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLER 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 66/170 (39%)
ARL3NP_015274.1 Arfrp1 19..185 CDD:206725 65/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.