DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and ARF3

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_014737.1 Gene:ARF3 / 854261 SGDID:S000005620 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:68/159 - (42%)
Similarity:103/159 - (64%) Gaps:1/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWRN 79
            :||:||:||||.|||||||.:.....|.|.:||:|||::|:.:.....||||||||:.||..||:
Yeast    16 KEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRH 80

  Fly    80 YFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHL 144
            ||.:|..|::|:||:.|.|:|...:||..::.|:.:....|||..|||||..|:...|:.:.|.|
Yeast    81 YFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLEL 145

  Fly   145 E-DITTHHWLVAGVSAVTGEKLLSSMDWL 172
            | ::....|.|.|.:|::|:.|:..:.|:
Yeast   146 EKNLKNQPWCVIGSNALSGQGLVEGLSWI 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 68/159 (43%)
ARF3NP_014737.1 Arf6 9..177 CDD:206716 68/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.