DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and AT1G02620

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001318907.1 Gene:AT1G02620 / 839269 AraportID:AT1G02620 Length:122 Species:Arabidopsis thaliana


Alignment Length:70 Identity:28/70 - (40%)
Similarity:41/70 - (58%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHL 144
            :|...|.||::||:.|:.|.....:||..||.:|.||....|:|.||.|:|.|.|.:|::..|.|
plant    13 WFSQVDALVYLVDAYDQERFAESKKELDALLSDESLATVPFLILGNKIDIPYAASEDELRFHLGL 77

  Fly   145 EDITT 149
            .:.||
plant    78 SNFTT 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 28/70 (40%)
AT1G02620NP_001318907.1 SAR <12..121 CDD:197556 28/70 (40%)

Return to query results.
Submit another query.