DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and ARFD1B

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_171745.3 Gene:ARFD1B / 839242 AraportID:AT1G02430 Length:190 Species:Arabidopsis thaliana


Alignment Length:181 Identity:60/181 - (33%)
Similarity:102/181 - (56%) Gaps:19/181 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EREMRILLLGLDNAGKTTILKRF-NGEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYW 77
            :.|.||:|.|||.|||::|:.:. .||.:.|..||:|.:::::::....|..|::|||:..:  |
plant    15 QEESRIVLFGLDAAGKSSIMHKLKTGETLTTTMPTIGTDVESVKYKDSNLRFWEMGGQQCYK--W 77

  Fly    78 ----RNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGA-----TLLVLCNKQDLPGAL 133
                ::.|:...|||.||||.||.|:|.....|..::.|  :.|:     .:||..||.::|||:
plant    78 FPMTKHDFQEIAGLVLVVDSTDRDRIEDAKDFLNAVIDE--IQGSVPDNVAVLVFGNKHEVPGAM 140

  Fly   134 SSNEIKEILHLEDIT----THHWLVAGVSAVTGEKLLSSMDWLIADIAKRI 180
            |::||...|.|..:.    ..:|.|....|.:|:.|...:|||:.: |:|:
plant   141 SASEISNKLDLTSLRQKNWQRNWHVQSSCAFSGDGLHEGLDWLLKN-AERM 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 58/174 (33%)
ARFD1BNP_171745.3 Arf_Arl 19..186 CDD:206644 57/170 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.