DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and GB1

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_200034.1 Gene:GB1 / 835297 AraportID:AT5G52210 Length:205 Species:Arabidopsis thaliana


Alignment Length:170 Identity:63/170 - (37%)
Similarity:94/170 - (55%) Gaps:7/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMRILLLGLDNAGKTTILKRF-------NGEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSL 73
            |..:|:||:|.|||||.|::.       .|.|.|.|.||:|.||..:|.:...:..||:|||..|
plant    17 EFNVLILGIDKAGKTTFLEKLKTIYSISEGLPHDRIVPTVGLNIGRIEVSNAKIVFWDLGGQPGL 81

  Fly    74 RSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEI 138
            ||.|..|:|....|::::|:|...|.|.....|:..|:.|.|.||.||:|.|||||..|:|:.|:
plant    82 RSIWEKYYEEAHALIYLIDAACPTRFEDSKSALEKALRHEDLQGAPLLILANKQDLTNAVSAEEL 146

  Fly   139 KEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAK 178
            ...|.|:.:....::...||...|..:..|::||:..:.|
plant   147 DRYLDLKKLDERVYMFEAVSGYDGRGIKESIEWLVGVMEK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 62/165 (38%)
GB1NP_200034.1 Arfrp1 19..183 CDD:206725 61/163 (37%)

Return to query results.
Submit another query.