DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Sar1b

DIOPT Version :10

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_079811.1 Gene:Sar1b / 66397 MGIID:1913647 Length:198 Species:Mus musculus


Alignment Length:179 Identity:58/179 - (32%)
Similarity:96/179 - (53%) Gaps:7/179 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMWD 66
            ||.:||:.:...::..:::.||||||||||:|.....:.:....|||....:.|...|.|...:|
Mouse    11 GFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFD 75

  Fly    67 VGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPG 131
            :||....|..|:||..:.:|:|::||.||..||....:||..|:.:|.:|...:|:|.||.|.|.
Mouse    76 LGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE 140

  Fly   132 ALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKL-LSSMDWLIADIAKR 179
            |:|...::|:..|...||      |..:|:.::| ...::..:..:.||
Mouse   141 AISEERLREMFGLYGQTT------GKGSVSLKELNARPLEVFMCSVLKR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 55/172 (32%)
Sar1bNP_079811.1 Sar1 3..197 CDD:206645 58/179 (32%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5
Mediates recruitment to ER membranes. /evidence=ECO:0000250|UniProtKB:Q9QVY3 15..19 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.