DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arl2

DIOPT Version :9

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_062696.2 Gene:Arl2 / 56327 MGIID:1928393 Length:184 Species:Mus musculus


Alignment Length:184 Identity:136/184 - (73%)
Similarity:158/184 - (85%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMW 65
            ||.||:||||:|||||:|:|:|||||||||||||:||||.:||||||||||||||||.|:.||:|
Mouse     1 MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIW 65

  Fly    66 DVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLP 130
            ||||||||||||||||||||||:||||||||.|::.|.:|||.||.||||||||||:..||||||
Mouse    66 DVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLP 130

  Fly   131 GALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKRIFTLD 184
            ||||.|.|:|.|.|:.|.:|||.:.|.||||||.||..:|||:.||:.|:||.|
Mouse   131 GALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFTAD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 128/171 (75%)
Arl2NP_062696.2 Arl2 3..175 CDD:206720 128/171 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848576
Domainoid 1 1.000 275 1.000 Domainoid score I1750
eggNOG 1 0.900 - - E1_KOG0073
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1260
Inparanoid 1 1.050 290 1.000 Inparanoid score I2787
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53567
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0005745
OrthoInspector 1 1.000 - - oto92879
orthoMCL 1 0.900 - - OOG6_103223
Panther 1 1.100 - - LDO PTHR45697
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R81
SonicParanoid 1 1.000 - - X4140
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.